avidin

share

Examples
avidin's examples

  • Rabbit polyclonal to Avidin. The biological function of avidin is not known. It is a homotetrameric glycoprotein found in chicken egg white, and forms a strong non covalent specif. — “Avidin antibody (ab6675) | Abcam”,
  • We also designed and synthesized a variety of additional group-specific biotinylating reagents and developed many new applications of the avidin-biotin system (Figure 2). The overall objectives of our work on the avidin-biotin system have included the following:. — “head”, weizmann.ac.il
  • Definition of avidin in the Online Dictionary. Meaning of avidin. Pronunciation of avidin. Translations of avidin. avidin synonyms, avidin antonyms. Information about avidin in the free online English dictionary and encyclopedia. — “avidin - definition of avidin by the Free Online Dictionary”,
  • Avidin is a tetrameric biotin-binding protein produced in the oviducts of birds, reptiles and amphibians deposited in the whites of their eggs. In chicken egg white, avidin makes up approximately 0.05% of total protein (approximately 1.8 mg per egg). — “Avidin - Wikipedia, the free encyclopedia”,
  • Avidin is a protein present in hen egg white and tissues of birds. Avidin has been suggested to act as an antibacterial protein like other egg white proteins, such as Lysozyme and Conalbumin. While its action is not yet fully ascertained it seems that its high affinity for Biotin deprives the. — “Fordras S.A. : Avidin”,
  • 26 possible paths to "Avidin, HRP conjugated/tagged" Life Science Products / Laboratory Supplies " Cell Biology " Biomolecules " Antibodies " Histochemistry / Immunohistochemistry " Immunohistochemistry Reagents " Avidin/Streptavidin Enzymes " Avidin / Streptavidin HRP " Avidin, HRP conjugated/tagged. — “26 possible paths to "Avidin, HRP conjugated/tagged”,
  • Here we report, to our knowledge, the first biochemical and structural characterization of an amphibian avidin - xenavidin - a frog avidin from Xenopus tropicalis. an avidin-like protein from a frog were originally identified by. — “BioMed Central | Full text | Structural and functional”,
  • Definition of avidin in the Medical Dictionary. avidin explanation. Information about avidin in Free online English dictionary. What is avidin? Meaning of avidin medical term. What does avidin mean?. — “avidin - definition of avidin in the Medical dictionary - by”, medical-
  • Avidin definition, a protein, found in the white of egg, that combines with and prevents the action of biotin, thus injuring the animal that consumes it in exc See more. — “Avidin | Define Avidin at ”,
  • sp|P02701|AVID_CHICK Avidin OS=Gallus gallus GN=AVD PE=1 SV=3 MVHATSPLLLLLLLSLALVAPGLSARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITA "Cloning and sequencing of the chicken egg-white avidin-encoding gene and its relationship with the avidin-related genes Avr1-Avr5. — “Avidin precursor - Gallus gallus (Chicken)”,
  • Avidin plays an important role in biotin function studies and in the study of several enzymes in which biotin is a coenzyme. Avidin or avidin subunits bound to a matrix have been utilized for affinity purification (Berger and Wood, 1975; Green and Toms, 1973). — “Avidin - Worthington Enzyme Manual”, worthington-
  • Avidin biotin-binding protein immobilized to agarose beads for affinity purification of biotinylated macromolecules in microcentrifuge tube or column format. — “Avidin Agarose”,
  • Avidin. You don't need to be Editor-In-Chief to add or edit content to WikiDoc. You can begin to add to or edit text on this WikiDoc page by clicking on the edit button at the top of this page. Next enter or edit the information that you would like to appear here. — “Avidin - wikidoc”,
  • Avidin (also called strepavidin) is a much larger protein that binds biotin with a very high affinity (figure 2) Because of their high affinity, investigators use biotin to tag a molecule of interest and avidin to extract the biotin-tagged protein. — “Biotin and Avidin Reagents”, bio.davidson.edu
  • Before we offered the Biotin-Avidin System, which now also includes the use of streptavidin, researchers used directly-labeled, enzyme-tagged primary and secondary antibodies for detection Avidin is an egg-white derived glycoprotein with an extraordinarily. — “Vector Labs: Biotin-(Strept)avidin Systems”,
  • Overview page of events, news, people, companies, organizations related to Avidin. — “Avidin - Silobreaker”,
  • This is because egg white contains a specific protein, avidin, that combines with biotin and thus prevents its absorption. Avidin is a glycoprotein that combines specifically with biotin, a vitamin. — “avidin (chemistry) -- Britannica Online Encyclopedia”,
  • avidin n. A protein found in uncooked egg white that binds to and inactivates biotin. An abundance of avidin in the diet can result in a deficiency. — “avidin: Definition from ”,
  • ProSpec's Avidins include: Avidin, Modified Affinity Purified Avidin. — “Avidin | ProSpec”,
  • Avidin is a tetrameric biotin-binding protein produced in the oviducts of birds, reptiles and amphibians deposited in the whites of their eggs. In chicken egg white, avidin makes up approximately 0.05% of total protein (approximately 1.8 mg per egg). — “Avidin”,
  • The high affinity of avidin for biotin was first exploited in histochemical applications in the mid-1970s. This egg-white protein and its bacterial counterpart, streptavidin, have since become standard reagents for diverse detection schemes. — “Avidin and Streptavidin Conjugates—Section 7.6”,

Videos
related videos for avidin

  • Wassanayata Hiru Avidin 6 tele drama
  • Wassanayata Hiru Avidin 14 tele drama
  • Oba ayemath avidin
  • Wassanayata Hiru Avidin 7 tele drama
  • Wassanayata Hiru Avidin 17 tele drama
  • Wassanayata Hiru Avidin 1 tele drama
  • Wassanayata Hiru Avidin 20 tele drama
  • Wassanayata Hiru Avidin 26 tele drama
  • Wassanayata Hiru Avidin 32 tele drama
  • Wassanayata Hiru Avidin 9 tele drama
  • Wassanayata Hiru Avidin 10 tele drama
  • Wassanayata Hiru Avidin 29 tele drama
  • Wassanayata Hiru Avidin 11 tele drama
  • Wassanayata Hiru Avidin 23 tele drama
  • Wassanayata Hiru Avidin 25 tele drama
  • Wassanayata Hiru Avidin 12 tele drama
  • Wassanayata Hiru Avidin 33 tele drama
  • Wassanayata Hiru Avidin 8 tele drama
  • Wassanayata Hiru Avidin 28 tele drama
  • Wassanayata Hiru Avidin 31 tele drama
  • Wassanayata Hiru Avidin 4 tele drama
  • Wassanayata Hiru Avidin 13 tele drama
  • Wassanayata Hiru Avidin 5 tele drama
  • Wassanayata Hiru Avidin 21 tele drama
  • (New) Mang Thaniyen Avidin - Vinod Attanayake (New) Mang Thaniyen Avidin - Vinod Attanayake new sinhala video song
  • Wassanayata Hiru Avidin 36 tele drama
  • Wassanayata Hiru Avidin 16 tele drama
  • Hinen Wath Avidin- indika prasad
  • Wassanayata Hiru Avidin 15 tele drama
  • Wassanayata Hiru Avidin 30 tele drama
  • Wassanayata Hiru Avidin 35 tele drama
  • Wassanayata Hiru Avidin 24 tele drama
  • Wassanayata Hiru Avidin 18 tele drama
  • Handa Panak se Avidin The original clip of the closing soundtrack of "Grande Ecole", a Robert Salis and Humbert Balsan film
  • Wassanayata Hiru Avidin 2 tele drama
  • Wassanayata Hiru Avidin 34 tele drama
  • Wassanayata Hiru Avidin 22 tele drama
  • Wassanayata Hiru Avidin 27 tele drama
  • Wassanayata Hiru Avidin 19 tele drama
  • Wassanayata Hiru Avidin 3 tele drama
  • Avidin: RT @FactHive: Price of 1 gigabyte of storage over time: 1981 $300,000 1987 $50,000 1990 $10,000 1994 $1,000 1997 $100 2000 $10 2004 $1 2012 $0.10
  • AlexFerentinos7: raw egg whites? No. Avidin is bonded to biotin preventing digestion, two minute poach is best http://t.co/XDj7CC4R @AidyMc1
  • mf1_q: RT @MuscleInsider: Avidin is an enzyme found in raw egg whites that blocks the absorption of vitamin B6 (aka Biotin). If u eat raw eggs, supplement w/Biotin.
  • jcarrilloromano: RT @MuscleInsider: Avidin is an enzyme found in raw egg whites that blocks the absorption of vitamin B6 (aka Biotin). If u eat raw eggs, supplement w/Biotin.
  • MuscleInsider: Avidin is an enzyme found in raw egg whites that blocks the absorption of vitamin B6 (aka Biotin). If u eat raw eggs, supplement w/Biotin.
  • Avidin: Nice: Clean (iOS) for windowsphone http://t.co/iGYtlED8
  • Avidin: A Windows Phone 8 Run Tracking App in 100 Lines of Code http://t.co/MdiMqzoc via @zite
  • ogcoop: @ThatNavajo this nigga @TheRealDjChi dont want it in 2k either. He been avidin me this whole break lol
  • NyawiraNjoroge: Why would anyone want to eat 28 raw eggs? What killed the person anyways? Doubt its the avidin.

Blogs & Forum
blogs and forums about avidin

  • “Posts Tagged Avidin Products' Second Step Reagents Price Reduction including our secondary antibodies, Steptavidin / Avidin, and Ultraavidin products”
    — Leinco Technologies " Avidin Products,

  • “avidin precipitating with biotin-oligos I am working with avidin and biotynilated DNA oligos, everytime I mix the water solutions of the Biotin-oligo and avidin a precipitate is formed, I am mixing at concentrations between 25 and 100 uM”
    — Scientist Solutions - Avidin precipitation,

  • “Anti-Biotin Gold: Do you know the advantage of an antibiotin gold vs strep-Avidin gold when detecting biotinylated proteins?”
    — Anti-Biotin Gold - BBI Diagnostic Forum - BBI,

  • “Eggs should never be eaten raw as there is a substance called avidin which hamperss the absorption of Biotin, (B Vitamin) biotin - avidin complex forms, it cannot be broken down nor liberated”
    — Moksh - The Wellness Place,

  • “Mountain Community - skiing, snowboarding, rock climbing, mountain biking, information, photos, articles, a business directory, an online forum and free classifieds for ski towns Egg protein contains avidin, biotin affects the absorption of food, the body loss of appetite, general”
    — Mountain Community :: View topic - eat the immature eggs, mountain-

  • “To prevent the loss of biotin, eggs should be soft boiled to kill the avidin which is the cause of the biotin problem. is best, in this case, the slight cooking still allows the egg to maintain plenty of nutrients while helping to kill the avidin”
    — Preparing Eggs,

  • “Archives of health blog from networlddirectory, the place for information They also attached biotin, which binds with extraordinary strength to avidin, to an antibody that binds to the TNF-æ protein”
    — Archives of health blog from NetWorlddirectory,

Keywords
related keywords for avidin